Lineage for d1f2eb1 (1f2e B:81-201)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48057Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 48058Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 48059Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (3 proteins)
  6. 48063Protein Glutathione S-transferase [47618] (24 species)
  7. 48316Species Sphingomonas paucimobilis [TaxId:13689] [47640] (1 PDB entry)
  8. 48318Domain d1f2eb1: 1f2e B:81-201 [17746]
    Other proteins in same PDB: d1f2ea2, d1f2eb2, d1f2ec2, d1f2ed2

Details for d1f2eb1

PDB Entry: 1f2e (more details), 2.3 Å

PDB Description: structure of sphingomonad, glutathione s-transferase complexed with glutathione

SCOP Domain Sequences for d1f2eb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f2eb1 a.45.1.1 (B:81-201) Glutathione S-transferase {Sphingomonas paucimobilis}
glapaegsldryrllsrlsflgsefhkafvplfapatsdeakaaaaesvknhlaaldkel
agrdhyagnafsvadiylyvmlgwpayvgidmaaypalgayagkiaqrpavgaalkaegl
a

SCOP Domain Coordinates for d1f2eb1:

Click to download the PDB-style file with coordinates for d1f2eb1.
(The format of our PDB-style files is described here.)

Timeline for d1f2eb1: