SCOP 1.55: Domain d1f2eb1: 1f2e B:81-201

Lineage for d1f2eb1 (1f2e B:81-201)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)

4. Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family)

5. Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (2 proteins)

6. Protein Glutathione S-transferase [47618] (22 species)

7. Species Sphingomonas paucimobilis [TaxId:13689] [47640] (1 PDB entry)

8. Domain d1f2eb1: 1f2e B:81-201 [17746]
   Other proteins in same PDB: d1f2ea2, d1f2eb2, d1f2ec2, d1f2ed2

Details for d1f2eb1

PDB Entry: 1f2e, 2.3 Å

PDB Description: structure of sphingomonad, glutathione s-transferase complexed with glutathione

SCOP Domain Sequences for d1f2eb1:

Sequence; same for both SEQRES and ATOM records:

>d1f2eb1 a.45.1.1 (B:81-201) Glutathione S-transferase {Sphingomonas paucimobilis}
glapaegsldryrllsrlsflgsefhkafvplfapatsdeakaaaaesvknhlaaldkel
agrdhyagnafsvadiylyvmlgwpayvgidmaaypalgayagkiaqrpavgaalkaegl
a

Timeline for d1f2eb1:

• d1f2eb1 appears in SCOP 1.57
  
• d1f2eb1 appears in the current release, SCOPe 2.08