Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins) |
Protein automated matches [190229] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187292] (156 PDB entries) |
Domain d3heka1: 3hek A:10-225 [177450] Other proteins in same PDB: d3heka2, d3hekb2 automated match to d1osfa_ complexed with bd0, po4 |
PDB Entry: 3hek (more details), 1.95 Å
SCOPe Domain Sequences for d3heka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3heka1 d.122.1.1 (A:10-225) automated matches {Human (Homo sapiens) [TaxId: 9606]} qpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpsk ldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadis migqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilh lkedqteyleerrikeivkkhsqfigypitlfveke
Timeline for d3heka1: