Lineage for d3heka1 (3hek A:10-225)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579776Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2579777Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2579778Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2580057Protein automated matches [190229] (13 species)
    not a true protein
  7. 2580090Species Human (Homo sapiens) [TaxId:9606] [187292] (156 PDB entries)
  8. 2580230Domain d3heka1: 3hek A:10-225 [177450]
    Other proteins in same PDB: d3heka2, d3hekb2
    automated match to d1osfa_
    complexed with bd0, po4

Details for d3heka1

PDB Entry: 3hek (more details), 1.95 Å

PDB Description: hsp90 n-terminal domain in complex with 1-{4-[(2r)-1-(5-chloro-2,4- dihydroxybenzoyl)pyrrolidin-2-yl]benzyl}-3,3-difluoropyrrolidinium
PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d3heka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3heka1 d.122.1.1 (A:10-225) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpsk
ldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadis
migqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilh
lkedqteyleerrikeivkkhsqfigypitlfveke

SCOPe Domain Coordinates for d3heka1:

Click to download the PDB-style file with coordinates for d3heka1.
(The format of our PDB-style files is described here.)

Timeline for d3heka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3heka2