Class a: All alpha proteins [46456] (284 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
Protein Class beta GST [81357] (3 species) |
Species Proteus mirabilis [TaxId:584] [47639] (2 PDB entries) |
Domain d2pmtc1: 2pmt C:81-201 [17743] Other proteins in same PDB: d2pmta2, d2pmtb2, d2pmtc2, d2pmtd2 |
PDB Entry: 2pmt (more details), 2.7 Å
SCOP Domain Sequences for d2pmtc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pmtc1 a.45.1.1 (C:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} nliappkaleryhqiewlnflasevhkgysplfssdtpesylpvvknklkskfvyindvl skqkcvcgdhftvadaylftlsqwaphvaldltdlshlqdylariaqrpnvhsalvtegl i
Timeline for d2pmtc1: