Lineage for d3hdza_ (3hdz A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1508295Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1508296Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1508381Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 1508633Protein automated matches [190370] (1 species)
    not a true protein
  7. 1508634Species Human (Homo sapiens) [TaxId:9606] [187208] (23 PDB entries)
  8. 1508635Domain d3hdza_: 3hdz A: [177417]
    automated match to d1t9sa_
    complexed with mg, pd6, zn

Details for d3hdza_

PDB Entry: 3hdz (more details), 1.8 Å

PDB Description: identification, synthesis, and sar of amino substituted pyrido[3, 2b]pryaziones as potent and selective pde5 inhibitors
PDB Compounds: (A:) cGMP-specific 3',5'-cyclic phosphodiesterase, cAMP-specific 3',5'-cyclic phosphodiesterase 4B

SCOPe Domain Sequences for d3hdza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hdza_ a.211.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevlc
rwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdld
hpgvsnqflintnselalmyndesvlehhhfdqclmilnspgnqilsglsieeykttlki
ikqailatdlalyikrrgeffelirknqfnledphekelflamlmtacdlsaitkpwpiq
qriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealthv
sedcfplldgcrknrqkwqalae

SCOPe Domain Coordinates for d3hdza_:

Click to download the PDB-style file with coordinates for d3hdza_.
(The format of our PDB-style files is described here.)

Timeline for d3hdza_: