SCOPe 2.04: Domain d3hcfa_: 3hcf A:

Lineage for d3hcfa_ (3hcf A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.15: Arylamine N-methyltransferase [69547] (3 proteins)
   automatically mapped to Pfam PF01234

6. Protein automated matches [190168] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186895] (33 PDB entries)

8. Domain d3hcfa_: 3hcf A: [177376]
   automated match to d1hnnb_
   complexed with edo, lt5, sah

Details for d3hcfa_

PDB Entry: 3hcf, 2.7 Å

PDB Description: crystal structure of hpnmt in complex with 3-trifluoromethyl phenylethanolamine and adohcy

PDB Compounds: (A:) Phenylethanolamine N-methyltransferase

SCOPe Domain Sequences for d3hcfa_:

Sequence; same for both SEQRES and ATOM records:

>d3hcfa_ c.66.1.15 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgrtlidigsgpt
vyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacliegkgecwqdk
erqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlasfqraldhitt
llrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdlrtyimpahlq
tgvddvkgvffawaqkv

Timeline for d3hcfa_:

• d3hcfa_ first appeared in SCOPe 2.01
  
• d3hcfa_ appears in SCOPe 2.03
  
• d3hcfa_ appears in SCOPe 2.05
  
• d3hcfa_ appears in the current release, SCOPe 2.08