Lineage for d3hc5a_ (3hc5 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 923324Protein Bile acid receptor FXR [101433] (2 species)
  7. 923325Species Human (Homo sapiens) [TaxId:9606] [101434] (5 PDB entries)
  8. 923330Domain d3hc5a_: 3hc5 A: [177363]
    automated match to d1osha_
    complexed with 82x, so4

Details for d3hc5a_

PDB Entry: 3hc5 (more details), 2.6 Å

PDB Description: fxr with src1 and gsk826
PDB Compounds: (A:) Bile acid receptor

SCOPe Domain Sequences for d3hc5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hc5a_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]}
eltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnhvqvlveftk
klpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdlleerirnsgisdeyit
pmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihq
penpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdvq

SCOPe Domain Coordinates for d3hc5a_:

Click to download the PDB-style file with coordinates for d3hc5a_.
(The format of our PDB-style files is described here.)

Timeline for d3hc5a_: