Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily) core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane |
Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) Pfam PF13853. Phylogeny described in PubMed 12761335 |
Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins) |
Protein Bacteriorhodopsin [56871] (3 species) a light-driven proton pump |
Species Halobacterium salinarum [TaxId:2242] [56873] (116 PDB entries) Uniprot P02945 17-245 |
Domain d3hana_: 3han A: [177346] automated match to d1cwqa_ complexed with ret; mutant |
PDB Entry: 3han (more details), 2.75 Å
SCOPe Domain Sequences for d3hana_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hana_ f.13.1.1 (A:) Bacteriorhodopsin {Halobacterium salinarum [TaxId: 2242]} grpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlapaiaftmylsmllgyg ltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglvg altkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsay pvvwligsegagivplnietllfmvldvsakvgfglillrsraif
Timeline for d3hana_: