SCOPe 2.01: Domain d3h7wa_: 3h7w A:

Lineage for d3h7wa_ (3h7w A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.7: Hypoxia-inducible factor Hif2a, C-terminal domain [103184] (2 proteins)
   contains PAC motif

6. Protein automated matches [191006] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188753] (5 PDB entries)

8. Domain d3h7wa_: 3h7w A: [177314]
   Other proteins in same PDB: d3h7wb_
   automated match to d1p97a_
   protein/DNA complex; complexed with 018

Details for d3h7wa_

PDB Entry: 3h7w, 1.65 Å

PDB Description: crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains with the artificial ligand ths017

PDB Compounds: (A:) Endothelial PAS domain-containing protein 1

SCOPe Domain Sequences for d3h7wa_:

Sequence, based on SEQRES records:

>d3h7wa_ d.110.3.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fkgldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqn
lctkgqvvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlseiek

Sequence, based on observed residues (ATOM records):

>d3h7wa_ d.110.3.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fkgldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqn
lctkgqvvsgqyrmlakhggyvwletqgtviypqcimcvnyvlseiek

Timeline for d3h7wa_:

• d3h7wa_ is new in SCOPe 2.01-stable
  
• d3h7wa_ appears in SCOPe 2.02
  
• d3h7wa_ appears in the current release, SCOPe 2.08, called d3h7wa1