SCOPe 2.08: Domain d3h6tc_: 3h6t C:

Lineage for d3h6tc_ (3h6t C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (158 PDB entries)

8. Domain d3h6tc_: 3h6t C: [177295]
   Other proteins in same PDB: d3h6ta2, d3h6tb2
   automated match to d1lbcb_
   complexed with act, cac, cyz, dms, glu, gol, zn

Details for d3h6tc_

PDB Entry: 3h6t, 2.25 Å

PDB Description: crystal structure of the iglur2 ligand-binding core (s1s2j-n754s) in complex with glutamate and cyclothiazide at 2.25 a resolution

PDB Compounds: (C:) Glutamate receptor 2

SCOPe Domain Sequences for d3h6tc_:

Sequence; same for both SEQRES and ATOM records:

>d3h6tc_ c.94.1.1 (C:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkls
eqglldklknkwwydkgecgs

Timeline for d3h6tc_:

• d3h6tc_ first appeared in SCOPe 2.01
  
• d3h6tc_ appears in SCOPe 2.07