Lineage for d2gsqa1 (2gsq A:76-202)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270513Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1270514Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1270515Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1270996Protein Class sigma GST [81351] (5 species)
  7. 1271063Species Squid (Ommastrephes sloani pacificus) [TaxId:6634] [47631] (2 PDB entries)
  8. 1271064Domain d2gsqa1: 2gsq A:76-202 [17715]
    Other proteins in same PDB: d2gsqa2
    complexed with gbi, so4

Details for d2gsqa1

PDB Entry: 2gsq (more details), 2.2 Å

PDB Description: glutathione s-transferase from squid digestive gland complexed with s-(3-iodobenzyl)glutathione
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d2gsqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]}
ldgktslekyrvdeitetlqdifndvvkikfapeaakeavqqnyeksckrlapflegllv
sngggdgffvgnsmtladlhcyvalevplkhtpellkdcpkivalrkrvaecpkiaaylk
krpvrdf

SCOPe Domain Coordinates for d2gsqa1:

Click to download the PDB-style file with coordinates for d2gsqa1.
(The format of our PDB-style files is described here.)

Timeline for d2gsqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gsqa2