| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein Class sigma GST [81351] (5 species) |
| Species Squid (Ommastrephes sloani pacificus) [TaxId:6634] [47631] (2 PDB entries) |
| Domain d2gsqa1: 2gsq A:76-202 [17715] Other proteins in same PDB: d2gsqa2 complexed with gbi, so4 |
PDB Entry: 2gsq (more details), 2.2 Å
SCOPe Domain Sequences for d2gsqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]}
ldgktslekyrvdeitetlqdifndvvkikfapeaakeavqqnyeksckrlapflegllv
sngggdgffvgnsmtladlhcyvalevplkhtpellkdcpkivalrkrvaecpkiaaylk
krpvrdf
Timeline for d2gsqa1: