SCOPe 2.07: Domain d2gsqa1: 2gsq A:76-202

Lineage for d2gsqa1 (2gsq A:76-202)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class sigma GST [81351] (5 species)

7. Species Squid (Ommastrephes sloani pacificus) [TaxId:6634] [47631] (2 PDB entries)

8. Domain d2gsqa1: 2gsq A:76-202 [17715]
   Other proteins in same PDB: d2gsqa2
   complexed with gbi, so4

Details for d2gsqa1

PDB Entry: 2gsq, 2.2 Å

PDB Description: glutathione s-transferase from squid digestive gland complexed with s-(3-iodobenzyl)glutathione

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d2gsqa1:

Sequence; same for both SEQRES and ATOM records:

>d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]}
ldgktslekyrvdeitetlqdifndvvkikfapeaakeavqqnyeksckrlapflegllv
sngggdgffvgnsmtladlhcyvalevplkhtpellkdcpkivalrkrvaecpkiaaylk
krpvrdf

Timeline for d2gsqa1:

• d2gsqa1 first appeared (with stable ids) in SCOP 1.55, called d2gsq_1
  
• d2gsqa1 appears in SCOPe 2.06