| Class a: All alpha proteins [46456] (218 folds) |
| Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins) |
| Protein Class sigma GST [81351] (5 species) |
| Species Rat (Rattus norvegicus) [TaxId:10116] [47630] (1 PDB entry) synonym: hematopoietic prostaglandin D synthase |
| Domain d1pd221: 1pd2 2:76-199 [17714] Other proteins in same PDB: d1pd212, d1pd222 |
PDB Entry: 1pd2 (more details), 2.3 Å
SCOP Domain Sequences for d1pd221:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pd221 a.45.1.1 (2:76-199) Class sigma GST {Rat (Rattus norvegicus)}
dlagkteleqcqvdavvdtlddfmslfpwaeenqdlkertfndlltrqaphllkdldtyl
gdkewfignyvtwadfywdicsttllvlkpdllgiyprlvslrnkvqaipaisawilkrp
qtkl
Timeline for d1pd221: