Lineage for d1pd221 (1pd2 2:76-199)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 443394Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 443395Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 443396Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 443722Protein Class sigma GST [81351] (5 species)
  7. 443744Species Rat (Rattus norvegicus) [TaxId:10116] [47630] (1 PDB entry)
    synonym: hematopoietic prostaglandin D synthase
  8. 443746Domain d1pd221: 1pd2 2:76-199 [17714]
    Other proteins in same PDB: d1pd212, d1pd222

Details for d1pd221

PDB Entry: 1pd2 (more details), 2.3 Å

PDB Description: crystal structure of hematopoietic prostaglandin d synthase complex with glutathione

SCOP Domain Sequences for d1pd221:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pd221 a.45.1.1 (2:76-199) Class sigma GST {Rat (Rattus norvegicus)}
dlagkteleqcqvdavvdtlddfmslfpwaeenqdlkertfndlltrqaphllkdldtyl
gdkewfignyvtwadfywdicsttllvlkpdllgiyprlvslrnkvqaipaisawilkrp
qtkl

SCOP Domain Coordinates for d1pd221:

Click to download the PDB-style file with coordinates for d1pd221.
(The format of our PDB-style files is described here.)

Timeline for d1pd221:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pd222