SCOPe 2.08: Domain d1pd221: 1pd2 2:76-199

Lineage for d1pd221 (1pd2 2:76-199)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class sigma GST [81351] (5 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [47630] (3 PDB entries)
   synonym: hematopoietic prostaglandin D synthase

8. Domain d1pd221: 1pd2 2:76-199 [17714]
   Other proteins in same PDB: d1pd212, d1pd222
   complexed with gsh

Details for d1pd221

PDB Entry: 1pd2, 2.3 Å

PDB Description: crystal structure of hematopoietic prostaglandin d synthase complex with glutathione

PDB Compounds: (2:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d1pd221:

Sequence; same for both SEQRES and ATOM records:

>d1pd221 a.45.1.1 (2:76-199) Class sigma GST {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dlagkteleqcqvdavvdtlddfmslfpwaeenqdlkertfndlltrqaphllkdldtyl
gdkewfignyvtwadfywdicsttllvlkpdllgiyprlvslrnkvqaipaisawilkrp
qtkl

Timeline for d1pd221:

• d1pd221 first appeared (with stable ids) in SCOP 1.55
  
• d1pd221 appears in SCOPe 2.07