Lineage for d3h0oa_ (3h0o A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2050469Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 proteins)
    Pfam PF00722
    beta-Glucanase-like
  6. 2050553Protein automated matches [191047] (8 species)
    not a true protein
  7. 2050568Species Fibrobacter succinogenes [TaxId:833] [189311] (1 PDB entry)
  8. 2050569Domain d3h0oa_: 3h0o A: [177137]
    automated match to d1mvea_
    complexed with act, ca, trs

Details for d3h0oa_

PDB Entry: 3h0o (more details), 1.4 Å

PDB Description: the importance of ch-pi stacking interactions between carbohydrate and aromatic residues in truncated fibrobacter succinogenes 1,3-1,4-beta- d-glucanase
PDB Compounds: (A:) Beta-glucanase

SCOPe Domain Sequences for d3h0oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h0oa_ b.29.1.2 (A:) automated matches {Fibrobacter succinogenes [TaxId: 833]}
akdfsgaelytleevqygkfearmkmaaasgtvssmflyqngseiadgrpwvevdievlg
knpgsfqsniitgkagaqktsekhhavspaadqafhtyglewtpnyvrwtvdgqevrkte
ggqvsnltgtqglrfnlwssesaawvgqfdesklplfqfinwvkvykytpgqgeggsdft
ldwtdnfdtfdgsrwgkgdftfdgnrvdltdkniysrdgmlilaltrkgqesfngqvprd

SCOPe Domain Coordinates for d3h0oa_:

Click to download the PDB-style file with coordinates for d3h0oa_.
(The format of our PDB-style files is described here.)

Timeline for d3h0oa_: