SCOP 1.65: Domain d1pd211: 1pd2 1:76-199

Lineage for d1pd211 (1pd2 1:76-199)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)

6. Protein Class sigma GST [81351] (4 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [47630] (1 PDB entry)
   synonym: hematopoietic prostaglandin D synthase

8. Domain d1pd211: 1pd2 1:76-199 [17713]
   Other proteins in same PDB: d1pd212, d1pd222

Details for d1pd211

PDB Entry: 1pd2, 2.3 Å

PDB Description: crystal structure of hematopoietic prostaglandin d synthase complex with glutathione

SCOP Domain Sequences for d1pd211:

Sequence; same for both SEQRES and ATOM records:

>d1pd211 a.45.1.1 (1:76-199) Class sigma GST {Rat (Rattus norvegicus)}
dlagkteleqcqvdavvdtlddfmslfpwaeenqdlkertfndlltrqaphllkdldtyl
gdkewfignyvtwadfywdicsttllvlkpdllgiyprlvslrnkvqaipaisawilkrp
qtkl

Timeline for d1pd211:

• d1pd211 first appeared (with stable ids) in SCOP 1.55
  
• d1pd211 appears in SCOP 1.63
  
• d1pd211 appears in SCOP 1.67
  
• d1pd211 appears in the current release, SCOPe 2.08