Lineage for d1pd211 (1pd2 1:76-199)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713389Protein Class sigma GST [81351] (5 species)
  7. 2713452Species Norway rat (Rattus norvegicus) [TaxId:10116] [47630] (3 PDB entries)
    synonym: hematopoietic prostaglandin D synthase
  8. 2713457Domain d1pd211: 1pd2 1:76-199 [17713]
    Other proteins in same PDB: d1pd212, d1pd222
    complexed with gsh

Details for d1pd211

PDB Entry: 1pd2 (more details), 2.3 Å

PDB Description: crystal structure of hematopoietic prostaglandin d synthase complex with glutathione
PDB Compounds: (1:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d1pd211:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pd211 a.45.1.1 (1:76-199) Class sigma GST {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dlagkteleqcqvdavvdtlddfmslfpwaeenqdlkertfndlltrqaphllkdldtyl
gdkewfignyvtwadfywdicsttllvlkpdllgiyprlvslrnkvqaipaisawilkrp
qtkl

SCOPe Domain Coordinates for d1pd211:

Click to download the PDB-style file with coordinates for d1pd211.
(The format of our PDB-style files is described here.)

Timeline for d1pd211:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pd212