Lineage for d3ljra1 (3ljr A:80-244)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48057Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 48058Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 48059Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (3 proteins)
  6. 48063Protein Glutathione S-transferase [47618] (24 species)
  7. 48206Species Human (Homo sapiens), class theta [TaxId:9606] [47629] (3 PDB entries)
  8. 48211Domain d3ljra1: 3ljr A:80-244 [17711]
    Other proteins in same PDB: d3ljra2, d3ljrb2

Details for d3ljra1

PDB Entry: 3ljr (more details), 3.3 Å

PDB Description: glutathione transferase (theta class) from human in complex with the glutathione conjugate of 1-menaphthyl sulfate

SCOP Domain Sequences for d3ljra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ljra1 a.45.1.1 (A:80-244) Glutathione S-transferase {Human (Homo sapiens), class theta}
tpdhwypsdlqararvheylgwhadcirgtfgiplwvqvlgpligvqvpeekvernrtam
dqalqwledkflgdrpflagqqvtladlmaleelmqpvalgyelfegrprlaawrgrvea
flgaelcqeahsiilsileqaakktlptpspeayqamllriarip

SCOP Domain Coordinates for d3ljra1:

Click to download the PDB-style file with coordinates for d3ljra1.
(The format of our PDB-style files is described here.)

Timeline for d3ljra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ljra2