SCOP 1.57: Domain d3ljrb1: 3ljr B:80-244

Lineage for d3ljrb1 (3ljr B:80-244)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)

4. Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family)

5. Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (3 proteins)

6. Protein Glutathione S-transferase [47618] (24 species)

7. Species Human (Homo sapiens), class theta [TaxId:9606] [47629] (3 PDB entries)

8. Domain d3ljrb1: 3ljr B:80-244 [17712]
   Other proteins in same PDB: d3ljra2, d3ljrb2

Details for d3ljrb1

PDB Entry: 3ljr, 3.3 Å

PDB Description: glutathione transferase (theta class) from human in complex with the glutathione conjugate of 1-menaphthyl sulfate

SCOP Domain Sequences for d3ljrb1:

Sequence; same for both SEQRES and ATOM records:

>d3ljrb1 a.45.1.1 (B:80-244) Glutathione S-transferase {Human (Homo sapiens), class theta}
tpdhwypsdlqararvheylgwhadcirgtfgiplwvqvlgpligvqvpeekvernrtam
dqalqwledkflgdrpflagqqvtladlmaleelmqpvalgyelfegrprlaawrgrvea
flgaelcqeahsiilsileqaakktlptpspeayqamllriarip

Timeline for d3ljrb1:

• d3ljrb1 first appeared (with stable ids) in SCOP 1.55
  
• d3ljrb1 appears in SCOP 1.59
  
• d3ljrb1 appears in the current release, SCOPe 2.08