SCOPe 2.07: Domain d3gwta_: 3gwt A:

Lineage for d3gwta_ (3gwt A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48550] (31 PDB entries)
   Uniprot Q07343 324-667

8. Domain d3gwta_: 3gwt A: [177061]
   automated match to d1f0ja_
   complexed with 066, ars, gol, mg, zn

Details for d3gwta_

PDB Entry: 3gwt, 1.75 Å

PDB Description: catalytic domain of human phosphodiesterase 4b2b in complex with a quinoline inhibitor

PDB Compounds: (A:) cAMP-specific 3',5'-cyclic phosphodiesterase 4B

SCOPe Domain Sequences for d3gwta_:

Sequence; same for both SEQRES and ATOM records:

>d3gwta_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens) [TaxId: 9606]}
sisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfri
ssdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaa
aihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqr
qtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhca
dlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyiv
hplwetwadlvqpdaqdildtlednrnwyqamipqa

Timeline for d3gwta_:

• d3gwta_ first appeared in SCOPe 2.01
  
• d3gwta_ appears in SCOPe 2.06
  
• d3gwta_ appears in the current release, SCOPe 2.08