Class a: All alpha proteins [46456] (179 folds) |
Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins) |
Protein Class alpha GST [81349] (8 species) |
Species Mouse (Mus musculus), (a1-4) [TaxId:10090] [47628] (2 PDB entries) |
Domain d1b48a1: 1b48 A:80-222 [17703] Other proteins in same PDB: d1b48a2, d1b48b2 |
PDB Entry: 1b48 (more details), 2.6 Å
SCOP Domain Sequences for d1b48a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4)} nlygkdlkervridmyadgtqdlmmmiavapfktpkekeesydlilsraktryfpvfeki lkdhgeaflvgnqlswadiqlleailmveelsapvlsdfpllqafktrisniptikkflq pgsqrkpppdgpyvevvrivlkf
Timeline for d1b48a1: