Lineage for d3grda_ (3grd A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1196747Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1197160Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1197799Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 1197800Protein automated matches [190205] (11 species)
    not a true protein
  7. 1197801Species Bacillus cereus [TaxId:222523] [188845] (1 PDB entry)
  8. 1197802Domain d3grda_: 3grd A: [176933]
    automated match to d3ec9a1
    complexed with act, na

Details for d3grda_

PDB Entry: 3grd (more details), 1.25 Å

PDB Description: crystal structure of ntf2-superfamily protein with unknown function (np_977240.1) from bacillus cereus atcc 10987 at 1.25 a resolution
PDB Compounds: (A:) uncharacterized NTF2-superfamily protein

SCOPe Domain Sequences for d3grda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3grda_ d.17.4.0 (A:) automated matches {Bacillus cereus [TaxId: 222523]}
mpkanleiirstyegsassnakhlaealsekvewteaegfpyggtyigveaimenvfsrl
gsewndykasvnmyhevsgkdviiaegmysgvykdtgksfeaefvhvwqlengkivkfkq
yvdshlvreamks

SCOPe Domain Coordinates for d3grda_:

Click to download the PDB-style file with coordinates for d3grda_.
(The format of our PDB-style files is described here.)

Timeline for d3grda_: