Lineage for d3gptg_ (3gpt G:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676433Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1676434Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1676603Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1678261Protein automated matches [190144] (7 species)
    not a true protein
  7. 1678282Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (39 PDB entries)
  8. 1678286Domain d3gptg_: 3gpt G: [176854]
    Other proteins in same PDB: d3gpt1_, d3gpt2_, d3gpta_, d3gptb_, d3gptc_, d3gptd_, d3gpte_, d3gptf_, d3gpth_, d3gpti_, d3gptj_, d3gptk_, d3gptl_, d3gptm_, d3gptn_, d3gpto_, d3gptp_, d3gptq_, d3gptr_, d3gpts_, d3gptt_, d3gptv_, d3gptw_, d3gptx_, d3gpty_, d3gptz_
    automated match to d1g65g_
    complexed with gpt

Details for d3gptg_

PDB Entry: 3gpt (more details), 2.41 Å

PDB Description: Crystal structure of the yeast 20S proteasome in complex with Salinosporamide derivatives: slow substrate ligand
PDB Compounds: (G:) Proteasome component C7-alpha

SCOPe Domain Sequences for d3gptg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gptg_ d.153.1.4 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOPe Domain Coordinates for d3gptg_:

Click to download the PDB-style file with coordinates for d3gptg_.
(The format of our PDB-style files is described here.)

Timeline for d3gptg_: