Lineage for d3gpjv_ (3gpj V:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1222614Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1222615Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1222781Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1223291Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1223300Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (34 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1223640Domain d3gpjv_: 3gpj V: [176838]
    Other proteins in same PDB: d3gpja_, d3gpjb_, d3gpjc_, d3gpje_, d3gpjf_, d3gpjg_, d3gpjo_, d3gpjp_, d3gpjq_, d3gpjs_, d3gpjt_, d3gpju_
    automated match to d1g0uh_
    complexed with sy2

Details for d3gpjv_

PDB Entry: 3gpj (more details), 2.7 Å

PDB Description: Crystal structure of the yeast 20S proteasome in complex with syringolin B
PDB Compounds: (V:) Proteasome component PUP1

SCOPe Domain Sequences for d3gpjv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gpjv_ d.153.1.4 (V:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd

SCOPe Domain Coordinates for d3gpjv_:

Click to download the PDB-style file with coordinates for d3gpjv_.
(The format of our PDB-style files is described here.)

Timeline for d3gpjv_: