Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
Protein automated matches [190032] (8 species) not a true protein |
Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries) |
Domain d3gp9a_: 3gp9 A: [176804] automated match to d2b8pa1 complexed with gdp, mg, po4 |
PDB Entry: 3gp9 (more details), 1.8 Å
SCOPe Domain Sequences for d3gp9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gp9a_ d.58.6.1 (A:) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]} aglqrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsy fndncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdsed savdeisiwfpet
Timeline for d3gp9a_: