Lineage for d3gp5a_ (3gp5 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1610508Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 1610509Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 1610510Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. 1610562Protein automated matches [190196] (7 species)
    not a true protein
  7. 1610563Species Burkholderia pseudomallei [TaxId:28450] [188843] (3 PDB entries)
  8. 1610570Domain d3gp5a_: 3gp5 A: [176801]
    automated match to d1e59a_
    complexed with 3pg, pg4, pg6, vo4

Details for d3gp5a_

PDB Entry: 3gp5 (more details), 2.25 Å

PDB Description: crystal structure of phosphoglyceromutase from burkholderia pseudomallei with 3-phosphoglyceric acid and vanadate
PDB Compounds: (A:) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase

SCOPe Domain Sequences for d3gp5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gp5a_ c.60.1.1 (A:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
myklvlirhgestwnkenrftgwvdvdlteqgnrearqagqllkeagytfdiaytsvlkr
airtlwhvqdqmdlmyvpvvhswrlnerhygalsglnkaetaakygdeqvlvwrrsydtp
ppalepgderapyadpryakvpreqlplteclkdtvarvlplwnesiapavkagkqvlia
ahgnslralikyldgisdadivglnipngvplvyeldesltpirhyylgdqeaiakaqaa
vaqqgksa

SCOPe Domain Coordinates for d3gp5a_:

Click to download the PDB-style file with coordinates for d3gp5a_.
(The format of our PDB-style files is described here.)

Timeline for d3gp5a_: