| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.98: BLIP-like [55647] (2 superfamilies) alpha(2)-beta(4); 2 layers: alpha/beta |
Superfamily d.98.1: beta-lactamase-inhibitor protein, BLIP [55648] (2 families) ![]() |
| Family d.98.1.0: automated matches [191579] (1 protein) not a true family |
| Protein automated matches [191029] (2 species) not a true protein |
| Species Streptomyces exfoliatus [TaxId:1905] [188842] (2 PDB entries) |
| Domain d3gmwd_: 3gmw D: [176761] Other proteins in same PDB: d3gmwa_, d3gmwc_ automated match to d1jtgb_ complexed with po4 |
PDB Entry: 3gmw (more details), 2.1 Å
SCOPe Domain Sequences for d3gmwd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gmwd_ d.98.1.0 (D:) automated matches {Streptomyces exfoliatus [TaxId: 1905]}
sgfsaekyeqiqfgmtfdevweigggeaacdtggvigdsilcftesgdyapyggfsftde
gelwskrneylykaktpsvklshynrtalgmteaqlwaavpkdscvsqgesypnwpaktg
feekyycaaatglfppsasfhltdgvltyryqrslt
Timeline for d3gmwd_: