Lineage for d3gmwd_ (3gmw D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967139Fold d.98: BLIP-like [55647] (2 superfamilies)
    alpha(2)-beta(4); 2 layers: alpha/beta
  4. 2967140Superfamily d.98.1: beta-lactamase-inhibitor protein, BLIP [55648] (2 families) (S)
  5. 2967168Family d.98.1.0: automated matches [191579] (1 protein)
    not a true family
  6. 2967169Protein automated matches [191029] (2 species)
    not a true protein
  7. 2967175Species Streptomyces exfoliatus [TaxId:1905] [188842] (2 PDB entries)
  8. 2967178Domain d3gmwd_: 3gmw D: [176761]
    Other proteins in same PDB: d3gmwa_, d3gmwc_
    automated match to d1jtgb_
    complexed with po4

Details for d3gmwd_

PDB Entry: 3gmw (more details), 2.1 Å

PDB Description: crystal structure of beta-lactamse inhibitory protein-i (blip-i) in complex with tem-1 beta-lactamase
PDB Compounds: (D:) Beta-lactamase inhibitory protein BLIP-I

SCOPe Domain Sequences for d3gmwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gmwd_ d.98.1.0 (D:) automated matches {Streptomyces exfoliatus [TaxId: 1905]}
sgfsaekyeqiqfgmtfdevweigggeaacdtggvigdsilcftesgdyapyggfsftde
gelwskrneylykaktpsvklshynrtalgmteaqlwaavpkdscvsqgesypnwpaktg
feekyycaaatglfppsasfhltdgvltyryqrslt

SCOPe Domain Coordinates for d3gmwd_:

Click to download the PDB-style file with coordinates for d3gmwd_.
(The format of our PDB-style files is described here.)

Timeline for d3gmwd_: