Lineage for d3gkta_ (3gkt A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301798Protein Neuroglobin [100978] (2 species)
  7. 2301806Species Mouse (Mus musculus) [TaxId:10090] [109625] (36 PDB entries)
    Uniprot Q9ER97
  8. 2301810Domain d3gkta_: 3gkt A: [176725]
    automated match to d1q1fa_
    complexed with hem, kr, so4

Details for d3gkta_

PDB Entry: 3gkt (more details), 1.86 Å

PDB Description: crystal structure of murine neuroglobin under kr pressure
PDB Compounds: (A:) neuroglobin

SCOPe Domain Sequences for d3gkta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gkta_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]}
rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymlekslg
pdftpatrtawsrlygavvqamsrgwdg

SCOPe Domain Coordinates for d3gkta_:

Click to download the PDB-style file with coordinates for d3gkta_.
(The format of our PDB-style files is described here.)

Timeline for d3gkta_: