Lineage for d1guhb1 (1guh B:81-222)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1491601Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1491602Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1491603Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1491614Protein Class alpha GST [81349] (8 species)
  7. 1491627Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (27 PDB entries)
    Uniprot P08263
  8. 1491687Domain d1guhb1: 1guh B:81-222 [17672]
    Other proteins in same PDB: d1guha2, d1guhb2, d1guhc2, d1guhd2
    complexed with gsb

Details for d1guhb1

PDB Entry: 1guh (more details), 2.6 Å

PDB Description: Structure determination and refinement of human alpha class glutathione transferase A1-1, and a comparison with the MU and PI class enzymes
PDB Compounds: (B:) glutathione s-transferase a1-1

SCOPe Domain Sequences for d1guhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1guhb1 a.45.1.1 (B:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf

SCOPe Domain Coordinates for d1guhb1:

Click to download the PDB-style file with coordinates for d1guhb1.
(The format of our PDB-style files is described here.)

Timeline for d1guhb1: