| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein Class alpha GST [81349] (8 species) |
| Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (27 PDB entries) Uniprot P08263 |
| Domain d1guhb1: 1guh B:81-222 [17672] Other proteins in same PDB: d1guha2, d1guhb2, d1guhc2, d1guhd2 complexed with gsb |
PDB Entry: 1guh (more details), 2.6 Å
SCOPe Domain Sequences for d1guhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1guhb1 a.45.1.1 (B:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf
Timeline for d1guhb1: