Lineage for d3gjod_ (3gjo D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1754423Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
    dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices
  4. 1754424Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) (S)
  5. 1754425Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins)
    Pfam PF03271
  6. 1754426Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (1 species)
  7. 1754427Species Human (Homo sapiens) [TaxId:9606] [140615] (8 PDB entries)
    Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254
  8. 1754441Domain d3gjod_: 3gjo D: [176712]
    automated match to d1yiga1

Details for d3gjod_

PDB Entry: 3gjo (more details), 2.5 Å

PDB Description: Crystal structure of human EB1 in complex with microtubule Tip localization signal peptide of MACF
PDB Compounds: (D:) Microtubule-associated protein RP/EB family member 1

SCOPe Domain Sequences for d3gjod_:

Sequence, based on SEQRES records: (download)

>d3gjod_ a.245.1.1 (D:) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
eaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyat

Sequence, based on observed residues (ATOM records): (download)

>d3gjod_ a.245.1.1 (D:) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
eaaelmqqvnvlkltvedlekerdfyfgklrnielicqendpvlqrivdilyat

SCOPe Domain Coordinates for d3gjod_:

Click to download the PDB-style file with coordinates for d3gjod_.
(The format of our PDB-style files is described here.)

Timeline for d3gjod_: