SCOPe 2.06: Domain d3gg7a1: 3gg7 A:2-242

Lineage for d3gg7a1 (3gg7 A:2-242)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (26 species)
   not a true protein

7. Species Deinococcus radiodurans [TaxId:1299] [188838] (1 PDB entry)

8. Domain d3gg7a1: 3gg7 A:2-242 [176612]
   Other proteins in same PDB: d3gg7a2
   automated match to d1zzma1
   complexed with mn, mpd, mrd, so4

Details for d3gg7a1

PDB Entry: 3gg7, 1.5 Å

PDB Description: crystal structure of an uncharacterized metalloprotein from deinococcus radiodurans

PDB Compounds: (A:) uncharacterized metalloprotein

SCOPe Domain Sequences for d3gg7a1:

Sequence; same for both SEQRES and ATOM records:

>d3gg7a1 c.1.9.0 (A:2-242) automated matches {Deinococcus radiodurans [TaxId: 1299]}
idfhvhldlypdpvavaraceerqltvlsvtttpaawrgtlalaagrphvwtalgfhpev
vseraadlpwfdrylpetrfvgevgldgspslrgtwtqqfavfqhilrrcedhggrilsi
hsrraesevlncleanprsgtpilhwysgsvtelrraislgcwfsvgptmvrtqkgaali
rsmprdrvltetdgpfleldgqaalpwdvksvveglskiwqipaseverivkenvsrllg
t

Timeline for d3gg7a1:

• d3gg7a1 first appeared in SCOPe 2.01, called d3gg7a_
  
• d3gg7a1 was called d3gg7a_ in SCOPe 2.05
  
• d3gg7a1 appears in SCOPe 2.07
  
• d3gg7a1 appears in the current release, SCOPe 2.08