Lineage for d1gsca1 (1gsc A:85-217)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 355982Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 355983Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 355984Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 356107Protein Class mu GST [81348] (3 species)
  7. 356141Species Rat (Rattus norvegicus) [TaxId:10116] [47623] (16 PDB entries)
  8. 356172Domain d1gsca1: 1gsc A:85-217 [17657]
    Other proteins in same PDB: d1gsca2, d1gscb2, d1gscc2, d1gscd2

Details for d1gsca1

PDB Entry: 1gsc (more details), 2.5 Å

PDB Description: new crystal forms of a mu class glutathione s-transferase from rat liver

SCOP Domain Sequences for d1gsca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsca1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus)}
lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr
pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls
tpifsklaqwsnk

SCOP Domain Coordinates for d1gsca1:

Click to download the PDB-style file with coordinates for d1gsca1.
(The format of our PDB-style files is described here.)

Timeline for d1gsca1: