SCOPe 2.05: Domain d3g9pb_: 3g9p B:

Lineage for d3g9pb_ (3g9p B:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
   duplication: two zinc-binding motifs

6. Protein Glucocorticoid receptor DNA-binding domain [57730] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [57731] (11 PDB entries)

8. Domain d3g9pb_: 3g9p B: [176454]
   automated match to d1glua_
   protein/DNA complex; complexed with zn

Details for d3g9pb_

PDB Entry: 3g9p, 1.65 Å

PDB Description: gr dna binding domain:sgk 16bp complex-7

PDB Compounds: (B:) Glucocorticoid receptor

SCOPe Domain Sequences for d3g9pb_:

Sequence; same for both SEQRES and ATOM records:

>d3g9pb_ g.39.1.2 (B:) Glucocorticoid receptor DNA-binding domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
shmclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacr
yrkclqagmnleark

Timeline for d3g9pb_:

• d3g9pb_ first appeared in SCOPe 2.01
  
• d3g9pb_ appears in SCOPe 2.04
  
• d3g9pb_ is called d3g9pb1 in SCOPe 2.06
  
• d3g9pb_ appears in the current release, SCOPe 2.08, called d3g9pb1