SCOPe 2.06: Domain d3g9pb1: 3g9p B:440-511

Lineage for d3g9pb1 (3g9p B:440-511)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
   duplication: two zinc-binding motifs

6. Protein Glucocorticoid receptor DNA-binding domain [57730] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [57731] (11 PDB entries)

8. Domain d3g9pb1: 3g9p B:440-511 [176454]
   Other proteins in same PDB: d3g9pa2, d3g9pb2
   automated match to d1glua_
   protein/DNA complex; complexed with zn

Details for d3g9pb1

PDB Entry: 3g9p, 1.65 Å

PDB Description: gr dna binding domain:sgk 16bp complex-7

PDB Compounds: (B:) Glucocorticoid receptor

SCOPe Domain Sequences for d3g9pb1:

Sequence; same for both SEQRES and ATOM records:

>d3g9pb1 g.39.1.2 (B:440-511) Glucocorticoid receptor DNA-binding domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
clvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacryrk
clqagmnleark

Timeline for d3g9pb1:

• d3g9pb1 first appeared in SCOPe 2.01, called d3g9pb_
  
• d3g9pb1 was called d3g9pb_ in SCOPe 2.05
  
• d3g9pb1 appears in SCOPe 2.07
  
• d3g9pb1 appears in the current release, SCOPe 2.08