Lineage for d4gstb1 (4gst B:85-217)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 641765Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 641766Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 641767Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 641921Protein Class mu GST [81348] (3 species)
  7. 641983Species Rat (Rattus norvegicus) [TaxId:10116] [47623] (16 PDB entries)
  8. 641995Domain d4gstb1: 4gst B:85-217 [17640]
    Other proteins in same PDB: d4gsta2, d4gstb2
    complexed with gtd, so4

Details for d4gstb1

PDB Entry: 4gst (more details), 1.9 Å

PDB Description: reaction coordinate motion in an snar reaction catalyzed by glutathione transferase
PDB Compounds: (B:) glutathione s-transferase

SCOP Domain Sequences for d4gstb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gstb1 a.45.1.1 (B:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]}
lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr
pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls
tpifsklaqwsnk

SCOP Domain Coordinates for d4gstb1:

Click to download the PDB-style file with coordinates for d4gstb1.
(The format of our PDB-style files is described here.)

Timeline for d4gstb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gstb2