Lineage for d4gsta2 (4gst A:1-84)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 699243Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 699397Protein Class mu GST [81359] (3 species)
  7. 699459Species Rat (Rattus norvegicus) [TaxId:10116] [52868] (16 PDB entries)
  8. 699470Domain d4gsta2: 4gst A:1-84 [32933]
    Other proteins in same PDB: d4gsta1, d4gstb1

Details for d4gsta2

PDB Entry: 4gst (more details), 1.9 Å

PDB Description: reaction coordinate motion in an snar reaction catalyzed by glutathione transferase
PDB Compounds: (A:) glutathione s-transferase

SCOP Domain Sequences for d4gsta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gsta2 c.47.1.5 (A:1-84) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]}
pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh

SCOP Domain Coordinates for d4gsta2:

Click to download the PDB-style file with coordinates for d4gsta2.
(The format of our PDB-style files is described here.)

Timeline for d4gsta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gsta1