Lineage for d3g6qa1 (3g6q A:440-515)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035613Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
    duplication: two zinc-binding motifs
  6. 3035704Protein automated matches [190314] (3 species)
    not a true protein
  7. 3035721Species Norway rat (Rattus norvegicus) [TaxId:10116] [188856] (11 PDB entries)
  8. 3035740Domain d3g6qa1: 3g6q A:440-515 [176388]
    Other proteins in same PDB: d3g6qa2, d3g6qb2
    automated match to d1glua_
    protein/DNA complex; complexed with zn

Details for d3g6qa1

PDB Entry: 3g6q (more details), 2.26 Å

PDB Description: gr dna binding domain:fkbp5 binding site complex-9
PDB Compounds: (A:) Glucocorticoid receptor

SCOPe Domain Sequences for d3g6qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g6qa1 g.39.1.2 (A:440-515) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
clvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacryrk
clqagmnlearktkkk

SCOPe Domain Coordinates for d3g6qa1:

Click to download the PDB-style file with coordinates for d3g6qa1.
(The format of our PDB-style files is described here.)

Timeline for d3g6qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3g6qa2