| Class g: Small proteins [56992] (100 folds) |
| Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
| Family g.39.1.2: Nuclear receptor [57721] (13 proteins) duplication: two zinc-binding motifs |
| Protein automated matches [190314] (3 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [188856] (11 PDB entries) |
| Domain d3g6qa1: 3g6q A:440-515 [176388] Other proteins in same PDB: d3g6qa2, d3g6qb2 automated match to d1glua_ protein/DNA complex; complexed with zn |
PDB Entry: 3g6q (more details), 2.26 Å
SCOPe Domain Sequences for d3g6qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g6qa1 g.39.1.2 (A:440-515) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
clvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacryrk
clqagmnlearktkkk
Timeline for d3g6qa1: