Lineage for d3g4ca_ (3g4c A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1685571Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
    complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354
  4. 1685572Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (1 family) (S)
    automatically mapped to Pfam PF02511
  5. 1685573Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins)
  6. 1685652Protein automated matches [191028] (2 species)
    not a true protein
  7. 1685653Species Thermotoga maritima [TaxId:2336] [188857] (1 PDB entry)
  8. 1685654Domain d3g4ca_: 3g4c A: [176346]
    automated match to d1kq4b_
    complexed with fad, ump; mutant

Details for d3g4ca_

PDB Entry: 3g4c (more details), 2.05 Å

PDB Description: flavine dependant thymidylate syntahse s88c mutant
PDB Compounds: (A:) Thymidylate synthase thyX

SCOPe Domain Sequences for d3g4ca_:

Sequence, based on SEQRES records: (download)

>d3g4ca_ d.207.1.1 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
hhmkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfe
hivftfhvkapifvarqwfrhriasynelcgrysklsyefyipsperlegykttipperv
tekiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlradsh
aqweiqqyalaiarifkekcpwtfeaflkyaykgdil

Sequence, based on observed residues (ATOM records): (download)

>d3g4ca_ d.207.1.1 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
hhmkidildkgfvelvdvmgndlsavraarvserdrhlieylmkhghetpfehivftfhv
kapifvarqwfrhriasynelcgrysklsyefyipsperlegykttippervtekiseiv
dkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlradshaqweiqqy
alaiarifkekcpwtfeaflkyaykgdil

SCOPe Domain Coordinates for d3g4ca_:

Click to download the PDB-style file with coordinates for d3g4ca_.
(The format of our PDB-style files is described here.)

Timeline for d3g4ca_: