Class a: All alpha proteins [46456] (171 folds) |
Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins) |
Protein Class mu GST [81348] (3 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [47623] (14 PDB entries) |
Domain d6gsvb1: 6gsv B:85-217 [17634] Other proteins in same PDB: d6gsva2, d6gsvb2 complexed with gps, so4; mutant |
PDB Entry: 6gsv (more details), 1.75 Å
SCOP Domain Sequences for d6gsvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gsvb1 a.45.1.1 (B:85-217) Class mu GST {Rat (Rattus norvegicus)} lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls tpifsklaqwsnk
Timeline for d6gsvb1: