Lineage for d3g34b_ (3g34 B:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1690252Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1690253Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1690254Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1690900Protein automated matches [190161] (19 species)
    not a true protein
  7. 1690950Species Escherichia coli [TaxId:562] [187306] (41 PDB entries)
  8. 1690974Domain d3g34b_: 3g34 B: [176324]
    automated match to d1iysa_
    complexed with 1ce, dms, po4

Details for d3g34b_

PDB Entry: 3g34 (more details), 1.31 Å

PDB Description: ctx-m-9 class a beta-lactamase complexed with compound 11 (1ce)
PDB Compounds: (B:) Beta-lactamase CTX-M-9a

SCOPe Domain Sequences for d3g34b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g34b_ e.3.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
savqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqsetq
kqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpgg
vtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraql
vtwlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftqpq
qnaesrrdvlasaariiaegl

SCOPe Domain Coordinates for d3g34b_:

Click to download the PDB-style file with coordinates for d3g34b_.
(The format of our PDB-style files is described here.)

Timeline for d3g34b_: