SCOPe 2.04: Domain d3g34b_: 3g34 B:

Lineage for d3g34b_ (3g34 B:)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (19 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187306] (41 PDB entries)

8. Domain d3g34b_: 3g34 B: [176324]
   automated match to d1iysa_
   complexed with 1ce, dms, po4

Details for d3g34b_

PDB Entry: 3g34, 1.31 Å

PDB Description: ctx-m-9 class a beta-lactamase complexed with compound 11 (1ce)

PDB Compounds: (B:) Beta-lactamase CTX-M-9a

SCOPe Domain Sequences for d3g34b_:

Sequence; same for both SEQRES and ATOM records:

>d3g34b_ e.3.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
savqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqsetq
kqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpgg
vtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraql
vtwlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftqpq
qnaesrrdvlasaariiaegl

Timeline for d3g34b_:

• d3g34b_ first appeared in SCOPe 2.01
  
• d3g34b_ appears in SCOPe 2.03
  
• d3g34b_ appears in SCOPe 2.05
  
• d3g34b_ appears in the current release, SCOPe 2.08