SCOPe 2.04: Domain d3fzmb_: 3fzm B:

Lineage for d3fzmb_ (3fzm B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.7: BAG domain [63491] (1 family)

5. Family a.7.7.1: BAG domain [63492] (4 proteins)
   Pfam PF02179
   this is a repeat family; one repeat unit is 1hx1 B:151-261 found in domain

6. Protein BAG-family molecular chaperon regulator-1, BAG1 [63493] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63494] (8 PDB entries)

8. Domain d3fzmb_: 3fzm B: [176214]
   Other proteins in same PDB: d3fzma1, d3fzma2
   automated match to d1hx1b_
   complexed with 3go

Details for d3fzmb_

PDB Entry: 3fzm, 2.3 Å

PDB Description: Crystal Structures of Hsc70/Bag1 in Complex with Small Molecule Inhibitors

PDB Compounds: (B:) BAG family molecular chaperone regulator 1

SCOPe Domain Sequences for d3fzmb_:

Sequence; same for both SEQRES and ATOM records:

>d3fzmb_ a.7.7.1 (B:) BAG-family molecular chaperon regulator-1, BAG1 {Human (Homo sapiens) [TaxId: 9606]}
gnspqeevelkklkhleksvekiadqleelnkeltgiqqgflpkdlqaealckldrrvka
tieqfmkileeidtlilpenfkdsrlkrkglvkkvqaflaecdtveqnicq

Timeline for d3fzmb_:

• d3fzmb_ first appeared in SCOPe 2.01
  
• d3fzmb_ appears in SCOPe 2.03
  
• d3fzmb_ appears in SCOPe 2.05
  
• d3fzmb_ appears in the current release, SCOPe 2.08, called d3fzmb1