Lineage for d3fzhb_ (3fzh B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1724371Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1724614Superfamily a.7.7: BAG domain [63491] (1 family) (S)
  5. 1724615Family a.7.7.1: BAG domain [63492] (4 proteins)
    Pfam PF02179
    this is a repeat family; one repeat unit is 1hx1 B:151-261 found in domain
  6. 1724616Protein BAG-family molecular chaperon regulator-1, BAG1 [63493] (3 species)
  7. 1724617Species Human (Homo sapiens) [TaxId:9606] [63494] (8 PDB entries)
  8. 1724620Domain d3fzhb_: 3fzh B: [176211]
    Other proteins in same PDB: d3fzha1, d3fzha2
    automated match to d1hx1b_
    complexed with 3bh

Details for d3fzhb_

PDB Entry: 3fzh (more details), 2 Å

PDB Description: Crystal Structures of Hsc70/Bag1 in Complex with Small Molecule Inhibitors
PDB Compounds: (B:) BAG family molecular chaperone regulator 1

SCOPe Domain Sequences for d3fzhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fzhb_ a.7.7.1 (B:) BAG-family molecular chaperon regulator-1, BAG1 {Human (Homo sapiens) [TaxId: 9606]}
gnspqeevelkklkhleksvekiadqleelnkeltgiqqgflpkdlqaealckldrrvka
tieqfmkileeidtlilpenfkdsrlkrkglvkkvqaflaecdtveqnicq

SCOPe Domain Coordinates for d3fzhb_:

Click to download the PDB-style file with coordinates for d3fzhb_.
(The format of our PDB-style files is described here.)

Timeline for d3fzhb_: