Lineage for d1hnbb1 (1hnb B:85-217)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 538429Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 538430Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 538431Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 538565Protein Class mu GST [81348] (3 species)
  7. 538573Species Human (Homo sapiens) [TaxId:9606] [47622] (10 PDB entries)
  8. 538599Domain d1hnbb1: 1hnb B:85-217 [17620]
    Other proteins in same PDB: d1hnba2, d1hnbb2
    complexed with gdn; mutant

Details for d1hnbb1

PDB Entry: 1hnb (more details), 3.5 Å

PDB Description: crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity

SCOP Domain Sequences for d1hnbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnbb1 a.45.1.1 (B:85-217) Class mu GST {Human (Homo sapiens)}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvftkmavfgnk

SCOP Domain Coordinates for d1hnbb1:

Click to download the PDB-style file with coordinates for d1hnbb1.
(The format of our PDB-style files is described here.)

Timeline for d1hnbb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hnbb2