SCOP 1.55: Domain d1hnbb1: 1hnb B:85-217

Lineage for d1hnbb1 (1hnb B:85-217)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)

4. Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family)

5. Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (2 proteins)

6. Protein Glutathione S-transferase [47618] (22 species)

7. Species Human (Homo sapiens), class mu [TaxId:9606] [47622] (7 PDB entries)

8. Domain d1hnbb1: 1hnb B:85-217 [17620]
   Other proteins in same PDB: d1hnba2, d1hnbb2

Details for d1hnbb1

PDB Entry: 1hnb, 3.5 Å

PDB Description: crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity

SCOP Domain Sequences for d1hnbb1:

Sequence; same for both SEQRES and ATOM records:

>d1hnbb1 a.45.1.1 (B:85-217) Glutathione S-transferase {Human (Homo sapiens), class mu}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvftkmavfgnk

Timeline for d1hnbb1:

• d1hnbb1 appears in SCOP 1.57
  
• d1hnbb1 appears in the current release, SCOPe 2.08