Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.6: Pyridoxal-dependent decarboxylase [69565] (4 proteins) automatically mapped to Pfam PF00282 |
Protein Glutamate decarboxylase beta, GadB [102596] (2 species) |
Species Escherichia coli K-12 [TaxId:83333] [188775] (3 PDB entries) |
Domain d3fz7d_: 3fz7 D: [176194] automated match to d1pmob_ complexed with po4 |
PDB Entry: 3fz7 (more details), 2.5 Å
SCOPe Domain Sequences for d3fz7d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fz7d_ c.67.1.6 (D:) Glutamate decarboxylase beta, GadB {Escherichia coli K-12 [TaxId: 83333]} lldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlatfcqtwddenv hklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtntigsseacml ggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipmrpgqlfmdpk rmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhidaasggflap fvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfnvdylggqigt fainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgpyefictgrpd egipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmrimcrrgfemd faellledykaslkylsdhpklqgiaqqnsfkht
Timeline for d3fz7d_: