SCOPe 2.06: Domain d3fz7b_: 3fz7 B:

Lineage for d3fz7b_ (3fz7 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.6: Pyridoxal-dependent decarboxylase [69565] (4 proteins)
   automatically mapped to Pfam PF00282

6. Protein Glutamate decarboxylase beta, GadB [102596] (2 species)

7. Species Escherichia coli K-12 [TaxId:83333] [188775] (3 PDB entries)

8. Domain d3fz7b_: 3fz7 B: [176192]
   automated match to d1pmob_
   complexed with po4

Details for d3fz7b_

PDB Entry: 3fz7, 2.5 Å

PDB Description: crystal structure of apo glutamate decarboxylase beta from escherichia coli

PDB Compounds: (B:) Glutamate decarboxylase beta

SCOPe Domain Sequences for d3fz7b_:

Sequence; same for both SEQRES and ATOM records:

>d3fz7b_ c.67.1.6 (B:) Glutamate decarboxylase beta, GadB {Escherichia coli K-12 [TaxId: 83333]}
elldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlatfcqtwdden
vhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtntigsseacm
lggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipmrpgqlfmdp
krmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhidaasggfla
pfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfnvdylggqig
tfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgpyefictgrp
degipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmrimcrrgfem
dfaellledykaslkylsdhpklqgiaqqnsfkht

Timeline for d3fz7b_:

• d3fz7b_ first appeared in SCOPe 2.01
  
• d3fz7b_ appears in SCOPe 2.05
  
• d3fz7b_ appears in SCOPe 2.07
  
• d3fz7b_ appears in the current release, SCOPe 2.08