SCOPe 2.01: Domain d3fyic_: 3fyi C:

Lineage for d3fyic_ (3fyi C:)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
   12 transmembrane helices in an approximate threefold rotational symmetric arrangement

4. Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family)

5. Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
   the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3

6. Protein Bacterial aa3 type cytochrome c oxidase subunit I [81436] (2 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81435] (6 PDB entries)

8. Domain d3fyic_: 3fyi C: [176140]
   automated match to d1m56a_
   complexed with ca, cd, cu1, cyn, dmu, hea, hto, mg, trd

Details for d3fyic_

PDB Entry: 3fyi, 2.2 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides in the reduced state bound with cyanide

PDB Compounds: (C:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d3fyic_:

Sequence; same for both SEQRES and ATOM records:

>d3fyic_ f.24.1.1 (C:) Bacterial aa3 type cytochrome c oxidase subunit I {Rhodobacter sphaeroides [TaxId: 1063]}
wfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgffqs
lwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdmafprmn
nlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhlsga
ssilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltdrnf
gttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpmvya
mvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwggsielkt
pmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagiyfw
igkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfvssl
gaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppeht

Timeline for d3fyic_:

• d3fyic_ is new in SCOPe 2.01-stable
  
• d3fyic_ appears in SCOPe 2.02
  
• d3fyic_ appears in the current release, SCOPe 2.08