SCOPe 2.07: Domain d3fszb_: 3fsz B:

Lineage for d3fszb_ (3fsz B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (96 PDB entries)
   Uniprot P00282

8. Domain d3fszb_: 3fsz B: [176044]
   automated match to d1azna_
   complexed with cu

Details for d3fszb_

PDB Entry: 3fsz, 2 Å

PDB Description: pseudomonas aeruginosa azurin with mutated metal-binding loop sequence (caaaahaaaam)

PDB Compounds: (B:) Azurin

SCOPe Domain Sequences for d3fszb_:

Sequence; same for both SEQRES and ATOM records:

>d3fszb_ b.6.1.1 (B:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffcaaaahaaa
amkgtltlk

Timeline for d3fszb_:

• d3fszb_ first appeared in SCOPe 2.01
  
• d3fszb_ appears in SCOPe 2.06
  
• d3fszb_ appears in the current release, SCOPe 2.08