Lineage for d1gtid1 (1gti D:79-209)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1491601Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1491602Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1491603Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1491918Protein Class pi GST [81347] (4 species)
  7. 1492039Species Mouse (Mus musculus) [TaxId:10090] [47621] (10 PDB entries)
  8. 1492059Domain d1gtid1: 1gti D:79-209 [17601]
    Other proteins in same PDB: d1gtia2, d1gtib2, d1gtic2, d1gtid2, d1gtie2, d1gtif2
    complexed with gtb

Details for d1gtid1

PDB Entry: 1gti (more details), 3 Å

PDB Description: modified glutathione s-transferase (pi) complexed with s (p- nitrobenzyl)glutathione
PDB Compounds: (D:) glutathione s-transferase

SCOPe Domain Sequences for d1gtid1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtid1 a.45.1.1 (D:79-209) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqnqg
gkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflsspeh
vnrpingngkq

SCOPe Domain Coordinates for d1gtid1:

Click to download the PDB-style file with coordinates for d1gtid1.
(The format of our PDB-style files is described here.)

Timeline for d1gtid1: